PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 131aa    MW: 14670.6 Da    PI: 7.3384
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609135.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13e-4312109198
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+++ +l+ el+
  XP_013609135.1  12 PCAACKFLRRKCTSDCVFAPYFPPEEPLKFANVHRIFGASNVSKILHEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQREVLRLQRELE 106
                     7********************************************************************************************99 PP

          DUF260  96 llk 98 
                     +++
  XP_013609135.1 107 ETN 109
                     876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8811112IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-4312108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MSSSYSNYTN SPCAACKFLR RKCTSDCVFA PYFPPEEPLK FANVHRIFGA SNVSKILHEV  60
APHQREDAVN SLAYEAEARL KDPVYGCVGA ISVLQREVLR LQRELEETNV DLMRYDSFLG  120
GETSAYGGRR G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0181141e-118AB018114.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGF10.
GenBankAB1643041e-118AB164304.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like gene 3 protein, partial cds.
GenBankAB4738361e-118AB473836.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like 3 protein, complete cds.
GenBankAF4478921e-118AF447892.1 Arabidopsis thaliana LOB DOMAIN 25 (LBD25) mRNA, complete cds.
GenBankCP0026861e-118CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695924.12e-94PREDICTED: LOB domain-containing protein 25-like
RefseqXP_013609135.12e-94PREDICTED: LOB domain-containing protein 25
RefseqXP_013609134.12e-94PREDICTED: LOB domain-containing protein 25
SwissprotQ8L8Q38e-86LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A078G3X52e-94A0A078G3X5_BRANA; BnaA09g02100D protein
TrEMBLA0A0D3E0H82e-94A0A0D3E0H8_BRAOL; Uncharacterized protein
STRINGBra039072.1-P2e-91(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-74LOB domain-containing protein 25